Anti GCA pAb (ATL-HPA035033 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035033-25

• 
• 
• 

Protein Description: grancalcin, EF-hand calcium binding protein
Gene Name: GCA
Alternative Gene Name: GCL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026893: 64%, ENSRNOG00000007359: 64%
Entrez Gene ID: 25801
Uniprot ID: P28676
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
• Gene Sequence: MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILLDGYSGPAYSDTYSSAGDSVYTYFSAV
• Gene ID - Mouse: ENSMUSG00000026893
• Gene ID - Rat: ENSRNOG00000007359
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.