Anti GC pAb (ATL-HPA019855 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019855-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GC
Alternative Gene Name: DBP, hDBP, VDBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035540: 85%, ENSRNOG00000003119: 86%
Entrez Gene ID: 2638
Uniprot ID: P02774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL |
Gene Sequence | LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL |
Gene ID - Mouse | ENSMUSG00000035540 |
Gene ID - Rat | ENSRNOG00000003119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GC pAb (ATL-HPA019855 w/enhanced validation) | |
Datasheet | Anti GC pAb (ATL-HPA019855 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GC pAb (ATL-HPA019855 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti GC pAb (ATL-HPA019855 w/enhanced validation) | |
Datasheet | Anti GC pAb (ATL-HPA019855 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti GC pAb (ATL-HPA019855 w/enhanced validation) |
Citations for Anti GC pAb (ATL-HPA019855 w/enhanced validation) – 2 Found |
Viloria, Katrina; Nasteska, Daniela; Briant, Linford J B; Heising, Silke; Larner, Dean P; Fine, Nicholas H F; Ashford, Fiona B; da Silva Xavier, Gabriela; Ramos, Maria Jiménez; Hasib, Annie; Cuozzo, Federica; Manning Fox, Jocelyn E; MacDonald, Patrick E; Akerman, Ildem; Lavery, Gareth G; Flaxman, Christine; Morgan, Noel G; Richardson, Sarah J; Hewison, Martin; Hodson, David J. Vitamin-D-Binding Protein Contributes to the Maintenance of α Cell Function and Glucagon Secretion. Cell Reports. 2020;31(11):107761. PubMed |
Debruin, Danielle A; Timpani, Cara A; Lalunio, Hannah; Rybalka, Emma; Goodman, Craig A; Hayes, Alan. Exercise May Ameliorate the Detrimental Side Effects of High Vitamin D Supplementation on Muscle Function in Mice. Journal Of Bone And Mineral Research : The Official Journal Of The American Society For Bone And Mineral Research. 2020;35(6):1092-1106. PubMed |