Anti GC pAb (ATL-HPA019855 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019855-25

• 
• 

Protein Description: group-specific component (vitamin D binding protein)
Gene Name: GC
Alternative Gene Name: DBP, hDBP, VDBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035540: 85%, ENSRNOG00000003119: 86%
Entrez Gene ID: 2638
Uniprot ID: P02774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL
• Gene Sequence: LGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLL
• Gene ID - Mouse: ENSMUSG00000035540
• Gene ID - Rat: ENSRNOG00000003119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GC pAb (ATL-HPA019855 w/enhanced validation) – 2 Found

Viloria, Katrina; Nasteska, Daniela; Briant, Linford J B; Heising, Silke; Larner, Dean P; Fine, Nicholas H F; Ashford, Fiona B; da Silva Xavier, Gabriela; Ramos, Maria Jiménez; Hasib, Annie; Cuozzo, Federica; Manning Fox, Jocelyn E; MacDonald, Patrick E; Akerman, Ildem; Lavery, Gareth G; Flaxman, Christine; Morgan, Noel G; Richardson, Sarah J; Hewison, Martin; Hodson, David J. Vitamin-D-Binding Protein Contributes to the Maintenance of α Cell Function and Glucagon Secretion. Cell Reports. 2020;31(11):107761. 

Debruin, Danielle A; Timpani, Cara A; Lalunio, Hannah; Rybalka, Emma; Goodman, Craig A; Hayes, Alan. Exercise May Ameliorate the Detrimental Side Effects of High Vitamin D Supplementation on Muscle Function in Mice. Journal Of Bone And Mineral Research : The Official Journal Of The American Society For Bone And Mineral Research. 2020;35(6):1092-1106.