Anti GC pAb (ATL-HPA001526 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001526-25

• 
• 

Protein Description: group-specific component (vitamin D binding protein)
Gene Name: GC
Alternative Gene Name: DBP, hDBP, VDBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035540: 69%, ENSRNOG00000003119: 64%
Entrez Gene ID: 2638
Uniprot ID: P02774
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD
• Gene Sequence: CESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCAD
• Gene ID - Mouse: ENSMUSG00000035540
• Gene ID - Rat: ENSRNOG00000003119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GC pAb (ATL-HPA001526 w/enhanced validation) – 1 Found

Toffalorio, F; Belloni, E; Barberis, M; Bucci, G; Tizzoni, L; Pruneri, G; Fumagalli, C; Spitaleri, G; Catania, C; Melotti, F; Pelicci, P G; Spaggiari, L; De Pas, T. Gene expression profiling reveals GC and CEACAM1 as new tools in the diagnosis of lung carcinoids. British Journal Of Cancer. 2014;110(5):1244-9.