Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027744-25

• 
• 

Protein Description: guanylate binding protein family, member 6
Gene Name: GBP6
Alternative Gene Name: DKFZp686G0786
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040253: 41%, ENSRNOG00000029191: 40%
Entrez Gene ID: 163351
Uniprot ID: Q6ZN66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
• Gene Sequence: EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
• Gene ID - Mouse: ENSMUSG00000040253
• Gene ID - Rat: ENSRNOG00000029191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) – 1 Found

Finke, Daniel; Heckmann, Markus B; Salatzki, Janek; Riffel, Johannes; Herpel, Esther; Heinzerling, Lucie M; Meder, Benjamin; Völkers, Mirko; Müller, Oliver J; Frey, Norbert; Katus, Hugo A; Leuschner, Florian; Kaya, Ziya; Lehmann, Lorenz H. Comparative Transcriptomics of Immune Checkpoint Inhibitor Myocarditis Identifies Guanylate Binding Protein 5 and 6 Dysregulation. Cancers. 2021;13(10)