Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027744-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: GBP6
Alternative Gene Name: DKFZp686G0786
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040253: 41%, ENSRNOG00000029191: 40%
Entrez Gene ID: 163351
Uniprot ID: Q6ZN66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV |
| Gene Sequence | EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV |
| Gene ID - Mouse | ENSMUSG00000040253 |
| Gene ID - Rat | ENSRNOG00000029191 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) | |
| Datasheet | Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) | |
| Datasheet | Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) |
| Citations for Anti GBP6 pAb (ATL-HPA027744 w/enhanced validation) – 1 Found |
| Finke, Daniel; Heckmann, Markus B; Salatzki, Janek; Riffel, Johannes; Herpel, Esther; Heinzerling, Lucie M; Meder, Benjamin; Völkers, Mirko; Müller, Oliver J; Frey, Norbert; Katus, Hugo A; Leuschner, Florian; Kaya, Ziya; Lehmann, Lorenz H. Comparative Transcriptomics of Immune Checkpoint Inhibitor Myocarditis Identifies Guanylate Binding Protein 5 and 6 Dysregulation. Cancers. 2021;13(10) PubMed |