Anti GBP5 pAb (ATL-HPA028656)

Atlas Antibodies

SKU: ATL-HPA028656-25

• 
• 

Protein Description: guanylate binding protein 5
Gene Name: GBP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000105504: 41%, ENSRNOG00000032240: 44%
Entrez Gene ID: 115362
Uniprot ID: Q96PP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL
• Gene Sequence: TDQALTETEKKKKEAQVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQAQNRSLLSELQHAQRTVNNDDPCVLL
• Gene ID - Mouse: ENSMUSG00000105504
• Gene ID - Rat: ENSRNOG00000032240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GBP5 pAb (ATL-HPA028656) – 2 Found

Carbotti, Grazia; Petretto, Andrea; Naschberger, Elisabeth; Stürzl, Michael; Martini, Stefania; Mingari, Maria Cristina; Filaci, Gilberto; Ferrini, Silvano; Fabbi, Marina. Cytokine-Induced Guanylate Binding Protein 1 (GBP1) Release from Human Ovarian Cancer Cells. Cancers. 2020;12(2) 

Finke, Daniel; Heckmann, Markus B; Salatzki, Janek; Riffel, Johannes; Herpel, Esther; Heinzerling, Lucie M; Meder, Benjamin; Völkers, Mirko; Müller, Oliver J; Frey, Norbert; Katus, Hugo A; Leuschner, Florian; Kaya, Ziya; Lehmann, Lorenz H. Comparative Transcriptomics of Immune Checkpoint Inhibitor Myocarditis Identifies Guanylate Binding Protein 5 and 6 Dysregulation. Cancers. 2021;13(10)