Anti GBP3 pAb (ATL-HPA045657)

Atlas Antibodies

Catalog No.:
ATL-HPA045657-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: guanylate binding protein 3
Gene Name: GBP3
Alternative Gene Name: FLJ10961
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 39%, ENSRNOG00000053428: 43%
Entrez Gene ID: 2635
Uniprot ID: Q9H0R5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK
Gene Sequence LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK
Gene ID - Mouse ENSMUSG00000022565
Gene ID - Rat ENSRNOG00000053428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GBP3 pAb (ATL-HPA045657)
Datasheet Anti GBP3 pAb (ATL-HPA045657) Datasheet (External Link)
Vendor Page Anti GBP3 pAb (ATL-HPA045657) at Atlas Antibodies

Documents & Links for Anti GBP3 pAb (ATL-HPA045657)
Datasheet Anti GBP3 pAb (ATL-HPA045657) Datasheet (External Link)
Vendor Page Anti GBP3 pAb (ATL-HPA045657)