Anti GBP2 pAb (ATL-HPA042682)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042682-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: GBP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028270: 47%, ENSRNOG00000002903: 39%
Entrez Gene ID: 2634
Uniprot ID: P32456
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL |
Gene Sequence | ERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL |
Gene ID - Mouse | ENSMUSG00000028270 |
Gene ID - Rat | ENSRNOG00000002903 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GBP2 pAb (ATL-HPA042682) | |
Datasheet | Anti GBP2 pAb (ATL-HPA042682) Datasheet (External Link) |
Vendor Page | Anti GBP2 pAb (ATL-HPA042682) at Atlas Antibodies |
Documents & Links for Anti GBP2 pAb (ATL-HPA042682) | |
Datasheet | Anti GBP2 pAb (ATL-HPA042682) Datasheet (External Link) |
Vendor Page | Anti GBP2 pAb (ATL-HPA042682) |
Citations for Anti GBP2 pAb (ATL-HPA042682) – 1 Found |
Carbotti, Grazia; Petretto, Andrea; Naschberger, Elisabeth; Stürzl, Michael; Martini, Stefania; Mingari, Maria Cristina; Filaci, Gilberto; Ferrini, Silvano; Fabbi, Marina. Cytokine-Induced Guanylate Binding Protein 1 (GBP1) Release from Human Ovarian Cancer Cells. Cancers. 2020;12(2) PubMed |