Anti GBE1 pAb (ATL-HPA038073 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038073-100

Protein Description: glucan (1,4-alpha-), branching enzyme 1
Gene Name: GBE1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022707: 95%, ENSRNOG00000051232: 69%
Entrez Gene ID: 2632
Uniprot ID: Q04446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMY
• Gene Sequence: LCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMY
• Gene ID - Mouse: ENSMUSG00000022707
• Gene ID - Rat: ENSRNOG00000051232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GBE1 pAb (ATL-HPA038073 w/enhanced validation) – 2 Found

Zois, Christos E; Hendriks, Anne M; Haider, Syed; Pires, Elisabete; Bridges, Esther; Kalamida, Dimitra; Voukantsis, Dimitrios; Lagerholm, B Christoffer; Fehrmann, Rudolf S N; den Dunnen, Wilfred F A; Tarasov, Andrei I; Baba, Otto; Morris, John; Buffa, Francesca M; McCullagh, James S O; Jalving, Mathilde; Harris, Adrian L. Liver glycogen phosphorylase is upregulated in glioblastoma and provides a metabolic vulnerability to high dose radiation. Cell Death & Disease. 2022;13(6):573. 

Krysa, Samantha J; Allen, Lee-Ann H. Metabolic Reprogramming Mediates Delayed Apoptosis of Human Neutrophils Infected With Francisella tularensis. Frontiers In Immunology. 13( 35693822):836754.