Anti GATB pAb (ATL-HPA042610)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042610-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GATB
Alternative Gene Name: PET112, PET112L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028085: 75%, ENSRNOG00000037655: 73%
Entrez Gene ID: 5188
Uniprot ID: O75879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK |
| Gene Sequence | WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK |
| Gene ID - Mouse | ENSMUSG00000028085 |
| Gene ID - Rat | ENSRNOG00000037655 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GATB pAb (ATL-HPA042610) | |
| Datasheet | Anti GATB pAb (ATL-HPA042610) Datasheet (External Link) |
| Vendor Page | Anti GATB pAb (ATL-HPA042610) at Atlas Antibodies |
| Documents & Links for Anti GATB pAb (ATL-HPA042610) | |
| Datasheet | Anti GATB pAb (ATL-HPA042610) Datasheet (External Link) |
| Vendor Page | Anti GATB pAb (ATL-HPA042610) |