Anti GATB pAb (ATL-HPA042610)

Atlas Antibodies

SKU: ATL-HPA042610-25

• 
• 
• 

Protein Description: glutamyl-tRNA(Gln) amidotransferase, subunit B
Gene Name: GATB
Alternative Gene Name: PET112, PET112L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028085: 75%, ENSRNOG00000037655: 73%
Entrez Gene ID: 5188
Uniprot ID: O75879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK
• Gene Sequence: WKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKK
• Gene ID - Mouse: ENSMUSG00000028085
• Gene ID - Rat: ENSRNOG00000037655
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.