Anti GATAD2B pAb (ATL-HPA017015 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA017015-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA017015 antibody. Corresponding GATAD2B RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in SK-BR-3 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GATAD2B antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GATA zinc finger domain containing 2B
Gene Name: GATAD2B
Alternative Gene Name: P66beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042390: 98%, ENSRNOG00000015553: 98%
Entrez Gene ID: 57459
Uniprot ID: Q8WXI9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLV
Gene Sequence NLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLRDELRLEEARLV
Gene ID - Mouse ENSMUSG00000042390
Gene ID - Rat ENSRNOG00000015553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti GATAD2B pAb (ATL-HPA017015 w/enhanced validation)
Datasheet Anti GATAD2B pAb (ATL-HPA017015 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GATAD2B pAb (ATL-HPA017015 w/enhanced validation)



Citations for Anti GATAD2B pAb (ATL-HPA017015 w/enhanced validation) – 1 Found
Bednarczyk, Joanna; Dębski, Konrad J; Bot, Anna M; Lukasiuk, Katarzyna. MBD3 expression and DNA binding patterns are altered in a rat model of temporal lobe epilepsy. Scientific Reports. 2016;6( 27650712):33736.  PubMed