Anti GATA2 pAb (ATL-HPA005633)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005633-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GATA2
Alternative Gene Name: NFE1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015053: 97%, ENSRNOG00000012347: 96%
Entrez Gene ID: 2624
Uniprot ID: P23769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
Gene Sequence | LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
Gene ID - Mouse | ENSMUSG00000015053 |
Gene ID - Rat | ENSRNOG00000012347 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GATA2 pAb (ATL-HPA005633) | |
Datasheet | Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link) |
Vendor Page | Anti GATA2 pAb (ATL-HPA005633) at Atlas Antibodies |
Documents & Links for Anti GATA2 pAb (ATL-HPA005633) | |
Datasheet | Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link) |
Vendor Page | Anti GATA2 pAb (ATL-HPA005633) |
Citations for Anti GATA2 pAb (ATL-HPA005633) – 1 Found |
Kohlmeier, Amanda; Sison, Christia Angela M; Yilmaz, Bahar D; Coon V, John S; Dyson, Matthew T; Bulun, Serdar E. GATA2 and Progesterone Receptor Interaction in Endometrial Stromal Cells Undergoing Decidualization. Endocrinology. 2020;161(6) PubMed |