Anti GATA2 pAb (ATL-HPA005633)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005633-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GATA2
Alternative Gene Name: NFE1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015053: 97%, ENSRNOG00000012347: 96%
Entrez Gene ID: 2624
Uniprot ID: P23769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
| Gene Sequence | LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG |
| Gene ID - Mouse | ENSMUSG00000015053 |
| Gene ID - Rat | ENSRNOG00000012347 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GATA2 pAb (ATL-HPA005633) | |
| Datasheet | Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link) |
| Vendor Page | Anti GATA2 pAb (ATL-HPA005633) at Atlas Antibodies |
| Documents & Links for Anti GATA2 pAb (ATL-HPA005633) | |
| Datasheet | Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link) |
| Vendor Page | Anti GATA2 pAb (ATL-HPA005633) |
| Citations for Anti GATA2 pAb (ATL-HPA005633) – 1 Found |
| Kohlmeier, Amanda; Sison, Christia Angela M; Yilmaz, Bahar D; Coon V, John S; Dyson, Matthew T; Bulun, Serdar E. GATA2 and Progesterone Receptor Interaction in Endometrial Stromal Cells Undergoing Decidualization. Endocrinology. 2020;161(6) PubMed |