Anti GATA2 pAb (ATL-HPA005633)

Atlas Antibodies

Catalog No.:
ATL-HPA005633-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: GATA binding protein 2
Gene Name: GATA2
Alternative Gene Name: NFE1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015053: 97%, ENSRNOG00000012347: 96%
Entrez Gene ID: 2624
Uniprot ID: P23769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
Gene Sequence LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
Gene ID - Mouse ENSMUSG00000015053
Gene ID - Rat ENSRNOG00000012347
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GATA2 pAb (ATL-HPA005633)
Datasheet Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link)
Vendor Page Anti GATA2 pAb (ATL-HPA005633) at Atlas Antibodies

Documents & Links for Anti GATA2 pAb (ATL-HPA005633)
Datasheet Anti GATA2 pAb (ATL-HPA005633) Datasheet (External Link)
Vendor Page Anti GATA2 pAb (ATL-HPA005633)
Citations for Anti GATA2 pAb (ATL-HPA005633) – 1 Found
Kohlmeier, Amanda; Sison, Christia Angela M; Yilmaz, Bahar D; Coon V, John S; Dyson, Matthew T; Bulun, Serdar E. GATA2 and Progesterone Receptor Interaction in Endometrial Stromal Cells Undergoing Decidualization. Endocrinology. 2020;161(6)  PubMed