Anti GATA2 pAb (ATL-HPA005633)

Atlas Antibodies

Catalog No.: ATL-HPA005633-25

Protein Description: GATA binding protein 2
Gene Name: GATA2
Alternative Gene Name: NFE1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015053: 97%, ENSRNOG00000012347: 96%
Entrez Gene ID: 2624
Uniprot ID: P23769
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
• Gene Sequence: LTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARG
• Gene ID - Mouse: ENSMUSG00000015053
• Gene ID - Rat: ENSRNOG00000012347
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GATA2 pAb (ATL-HPA005633) – 1 Found

Kohlmeier, Amanda; Sison, Christia Angela M; Yilmaz, Bahar D; Coon V, John S; Dyson, Matthew T; Bulun, Serdar E. GATA2 and Progesterone Receptor Interaction in Endometrial Stromal Cells Undergoing Decidualization. Endocrinology. 2020;161(6)