Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004838-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAS7
Alternative Gene Name: KIAA0394, MGC1348
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033066: 98%, ENSRNOG00000049361: 98%
Entrez Gene ID: 8522
Uniprot ID: O60861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS |
| Gene Sequence | KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS |
| Gene ID - Mouse | ENSMUSG00000033066 |
| Gene ID - Rat | ENSRNOG00000049361 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) | |
| Datasheet | Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) | |
| Datasheet | Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) |
| Citations for Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) – 1 Found |
| Meyer, Michael A. Neuronal localization of GAS7 within human brain tissue: Implications for schizophrenia research. Neurology International. 2018;10(4):7563. PubMed |