Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004838-25

• 
• 

Protein Description: growth arrest-specific 7
Gene Name: GAS7
Alternative Gene Name: KIAA0394, MGC1348
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033066: 98%, ENSRNOG00000049361: 98%
Entrez Gene ID: 8522
Uniprot ID: O60861
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS
• Gene Sequence: KQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKKSLADEAEVHLKFS
• Gene ID - Mouse: ENSMUSG00000033066
• Gene ID - Rat: ENSRNOG00000049361
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GAS7 pAb (ATL-HPA004838 w/enhanced validation) – 1 Found

Meyer, Michael A. Neuronal localization of GAS7 within human brain tissue: Implications for schizophrenia research. Neurology International. 2018;10(4):7563.