Anti GAS1 pAb (ATL-HPA036085)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036085-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GAS1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052957: 89%, ENSRNOG00000050485: 89%
Entrez Gene ID: 2619
Uniprot ID: P54826
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG |
Gene Sequence | TVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDG |
Gene ID - Mouse | ENSMUSG00000052957 |
Gene ID - Rat | ENSRNOG00000050485 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAS1 pAb (ATL-HPA036085) | |
Datasheet | Anti GAS1 pAb (ATL-HPA036085) Datasheet (External Link) |
Vendor Page | Anti GAS1 pAb (ATL-HPA036085) at Atlas Antibodies |
Documents & Links for Anti GAS1 pAb (ATL-HPA036085) | |
Datasheet | Anti GAS1 pAb (ATL-HPA036085) Datasheet (External Link) |
Vendor Page | Anti GAS1 pAb (ATL-HPA036085) |