Anti GARS pAb (ATL-HPA019097 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019097-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: glycyl-tRNA synthetase
Gene Name: GARS
Alternative Gene Name: CMT2D, DSMAV, GlyRS, SMAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029777: 95%, ENSRNOG00000011052: 95%
Entrez Gene ID: 2617
Uniprot ID: P41250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEG
Gene Sequence LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEG
Gene ID - Mouse ENSMUSG00000029777
Gene ID - Rat ENSRNOG00000011052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GARS pAb (ATL-HPA019097 w/enhanced validation)
Datasheet Anti GARS pAb (ATL-HPA019097 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GARS pAb (ATL-HPA019097 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GARS pAb (ATL-HPA019097 w/enhanced validation)
Datasheet Anti GARS pAb (ATL-HPA019097 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GARS pAb (ATL-HPA019097 w/enhanced validation)
Citations for Anti GARS pAb (ATL-HPA019097 w/enhanced validation) – 1 Found
Chen, Yun; Ruan, Zhi-Rong; Wang, Yong; Huang, Qian; Xue, Mei-Qin; Zhou, Xiao-Long; Wang, En-Duo. A threonyl-tRNA synthetase-like protein has tRNA aminoacylation and editing activities. Nucleic Acids Research. 2018;46(7):3643-3656.  PubMed