Anti GARS pAb (ATL-HPA019097 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019097-25

• 
• 

Protein Description: glycyl-tRNA synthetase
Gene Name: GARS
Alternative Gene Name: CMT2D, DSMAV, GlyRS, SMAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029777: 95%, ENSRNOG00000011052: 95%
Entrez Gene ID: 2617
Uniprot ID: P41250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEG
• Gene Sequence: LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEG
• Gene ID - Mouse: ENSMUSG00000029777
• Gene ID - Rat: ENSRNOG00000011052
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GARS pAb (ATL-HPA019097 w/enhanced validation) – 1 Found

Chen, Yun; Ruan, Zhi-Rong; Wang, Yong; Huang, Qian; Xue, Mei-Qin; Zhou, Xiao-Long; Wang, En-Duo. A threonyl-tRNA synthetase-like protein has tRNA aminoacylation and editing activities. Nucleic Acids Research. 2018;46(7):3643-3656.