Anti GARS pAb (ATL-HPA017896 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA017896-100
  • Immunohistochemical staining of human cerebral cortex, liver, pancreas and testis using Anti-GARS antibody HPA017896 (A) shows similar protein distribution across tissues to independent antibody HPA019097 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis using Anti-GARS antibody HPA017896 (A) shows similar pattern to independent antibody HPA019097 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: glycyl-tRNA synthetase
Gene Name: GARS
Alternative Gene Name: CMT2D, DSMAV, GlyRS, SMAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029777: 96%, ENSRNOG00000011052: 96%
Entrez Gene ID: 2617
Uniprot ID: P41250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQI
Gene Sequence KLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQI
Gene ID - Mouse ENSMUSG00000029777
Gene ID - Rat ENSRNOG00000011052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GARS pAb (ATL-HPA017896 w/enhanced validation)
Datasheet Anti GARS pAb (ATL-HPA017896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GARS pAb (ATL-HPA017896 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GARS pAb (ATL-HPA017896 w/enhanced validation)
Datasheet Anti GARS pAb (ATL-HPA017896 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GARS pAb (ATL-HPA017896 w/enhanced validation)