Anti GARNL3 pAb (ATL-HPA028757)

Atlas Antibodies

SKU:
ATL-HPA028757-25
  • Immunohistochemical staining of human smooth muscle shows cytoplasmic positivity in smooth muscle cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and GARNL3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410236).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GTPase activating Rap/RanGAP domain-like 3
Gene Name: GARNL3
Alternative Gene Name: bA356B19.1, DKFZp761J1523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038860: 91%, ENSRNOG00000057044: 91%
Entrez Gene ID: 84253
Uniprot ID: Q5VVW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP
Gene Sequence LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP
Gene ID - Mouse ENSMUSG00000038860
Gene ID - Rat ENSRNOG00000057044
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GARNL3 pAb (ATL-HPA028757)
Datasheet Anti GARNL3 pAb (ATL-HPA028757) Datasheet (External Link)
Vendor Page Anti GARNL3 pAb (ATL-HPA028757) at Atlas Antibodies

Documents & Links for Anti GARNL3 pAb (ATL-HPA028757)
Datasheet Anti GARNL3 pAb (ATL-HPA028757) Datasheet (External Link)
Vendor Page Anti GARNL3 pAb (ATL-HPA028757)