Anti GARNL3 pAb (ATL-HPA028757)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028757-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GARNL3
Alternative Gene Name: bA356B19.1, DKFZp761J1523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038860: 91%, ENSRNOG00000057044: 91%
Entrez Gene ID: 84253
Uniprot ID: Q5VVW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP |
Gene Sequence | LVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTP |
Gene ID - Mouse | ENSMUSG00000038860 |
Gene ID - Rat | ENSRNOG00000057044 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GARNL3 pAb (ATL-HPA028757) | |
Datasheet | Anti GARNL3 pAb (ATL-HPA028757) Datasheet (External Link) |
Vendor Page | Anti GARNL3 pAb (ATL-HPA028757) at Atlas Antibodies |
Documents & Links for Anti GARNL3 pAb (ATL-HPA028757) | |
Datasheet | Anti GARNL3 pAb (ATL-HPA028757) Datasheet (External Link) |
Vendor Page | Anti GARNL3 pAb (ATL-HPA028757) |