Anti GAREM1 pAb (ATL-HPA040709)

Atlas Antibodies

Catalog No.:
ATL-HPA040709-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: GRB2 associated regulator of MAPK1 subtype 1
Gene Name: GAREM1
Alternative Gene Name: C18orf11, FAM59A, FLJ21610, GAREM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042680: 95%, ENSRNOG00000048004: 35%
Entrez Gene ID: 64762
Uniprot ID: Q9H706
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILPMHFPLHLTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYARDELTQS
Gene Sequence ILPMHFPLHLTVPKFSLPEHLVKGESWPETLVHHWLGICQEQFDIDEYSRAVRDVKTDWNEECKSPKKGRCSGHNHVPNSLSYARDELTQS
Gene ID - Mouse ENSMUSG00000042680
Gene ID - Rat ENSRNOG00000048004
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAREM1 pAb (ATL-HPA040709)
Datasheet Anti GAREM1 pAb (ATL-HPA040709) Datasheet (External Link)
Vendor Page Anti GAREM1 pAb (ATL-HPA040709) at Atlas Antibodies

Documents & Links for Anti GAREM1 pAb (ATL-HPA040709)
Datasheet Anti GAREM1 pAb (ATL-HPA040709) Datasheet (External Link)
Vendor Page Anti GAREM1 pAb (ATL-HPA040709)