Anti GAPVD1 pAb (ATL-HPA029387)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029387-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GAPVD1
Alternative Gene Name: DKFZP434C212, KIAA1521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026867: 94%, ENSRNOG00000017925: 94%
Entrez Gene ID: 26130
Uniprot ID: Q14C86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP |
Gene Sequence | AMTGSEEGDPRTKSSLGKFDKSCVAAFLDVVIGGRAVETPPLSSVNLLEGLSRTVVYITYSQLITLVNFMKSVMSGDQLREDRMALDNLLANLP |
Gene ID - Mouse | ENSMUSG00000026867 |
Gene ID - Rat | ENSRNOG00000017925 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAPVD1 pAb (ATL-HPA029387) | |
Datasheet | Anti GAPVD1 pAb (ATL-HPA029387) Datasheet (External Link) |
Vendor Page | Anti GAPVD1 pAb (ATL-HPA029387) at Atlas Antibodies |
Documents & Links for Anti GAPVD1 pAb (ATL-HPA029387) | |
Datasheet | Anti GAPVD1 pAb (ATL-HPA029387) Datasheet (External Link) |
Vendor Page | Anti GAPVD1 pAb (ATL-HPA029387) |