Anti GAPVD1 pAb (ATL-HPA029386)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029386-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: GAPVD1
Alternative Gene Name: DKFZP434C212, KIAA1521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026867: 98%, ENSRNOG00000017925: 98%
Entrez Gene ID: 26130
Uniprot ID: Q14C86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL |
| Gene Sequence | SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL |
| Gene ID - Mouse | ENSMUSG00000026867 |
| Gene ID - Rat | ENSRNOG00000017925 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAPVD1 pAb (ATL-HPA029386) | |
| Datasheet | Anti GAPVD1 pAb (ATL-HPA029386) Datasheet (External Link) |
| Vendor Page | Anti GAPVD1 pAb (ATL-HPA029386) at Atlas Antibodies |
| Documents & Links for Anti GAPVD1 pAb (ATL-HPA029386) | |
| Datasheet | Anti GAPVD1 pAb (ATL-HPA029386) Datasheet (External Link) |
| Vendor Page | Anti GAPVD1 pAb (ATL-HPA029386) |