Anti GAPVD1 pAb (ATL-HPA029386)

Atlas Antibodies

Catalog No.: ATL-HPA029386-100

Protein Description: GTPase activating protein and VPS9 domains 1
Gene Name: GAPVD1
Alternative Gene Name: DKFZP434C212, KIAA1521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026867: 98%, ENSRNOG00000017925: 98%
Entrez Gene ID: 26130
Uniprot ID: Q14C86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL
• Gene Sequence: SSLDLEGESVSELGAGPSGSNGVEALQLLEHEQATTQDNLDDKLRKFEIRDMMGLTDDRDISETVSETWSTDVLGSDFDPNIDEDRLQEIAGAAAENMLGSLLCLPGSGSVLL
• Gene ID - Mouse: ENSMUSG00000026867
• Gene ID - Rat: ENSRNOG00000017925
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.