Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042666-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: glyceraldehyde-3-phosphate dehydrogenase, spermatogenic
Gene Name: GAPDHS
Alternative Gene Name: GAPD2, GAPDH-2, GAPDS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061099: 75%, ENSRNOG00000021009: 75%
Entrez Gene ID: 26330
Uniprot ID: O14556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
Gene Sequence KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS
Gene ID - Mouse ENSMUSG00000061099
Gene ID - Rat ENSRNOG00000021009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation)
Datasheet Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation)
Datasheet Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation)
Citations for Anti GAPDHS pAb (ATL-HPA042666 w/enhanced validation) – 2 Found
Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.  PubMed
Wu, Huan; Liu, Yiyuan; Li, Yuqian; Li, Kuokuo; Xu, Chuan; Gao, Yang; Lv, Mingrong; Guo, Rui; Xu, Yuping; Zhou, Ping; Wei, Zhaolian; Hua, Rong; He, Xiaojin; Cao, Yunxia. DNALI1 deficiency causes male infertility with severe asthenozoospermia in humans and mice by disrupting the assembly of the flagellar inner dynein arms and fibrous sheath. Cell Death & Disease. 2023;14(2):127.  PubMed