Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015600-25

• 
• 

Protein Description: growth associated protein 43
Gene Name: GAP43
Alternative Gene Name: B-50, PP46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047261: 71%, ENSRNOG00000001528: 70%
Entrez Gene ID: 2596
Uniprot ID: P17677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
• Gene Sequence: SFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKA
• Gene ID - Mouse: ENSMUSG00000047261
• Gene ID - Rat: ENSRNOG00000001528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GAP43 pAb (ATL-HPA015600 w/enhanced validation) – 4 Found

Phatak, Nitasha R; Stankowska, Dorota L; Krishnamoorthy, Raghu R. Transcription Factor Brn-3b Overexpression Enhances Neurite Outgrowth in PC12 Cells Under Condition of Hypoxia. Cellular And Molecular Neurobiology. 2015;35(6):769-83. 

Wu, Dongsheng; Lee, Sena; Luo, Juan; Xia, Haijian; Gushchina, Svetlana; Richardson, Peter M; Yeh, John; Krügel, Ute; Franke, Heike; Zhang, Yi; Bo, Xuenong. Intraneural Injection of ATP Stimulates Regeneration of Primary Sensory Axons in the Spinal Cord. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2018;38(6):1351-1365. 

Häggmark, Anna; Byström, Sanna; Ayoglu, Burcu; Qundos, Ulrika; Uhlén, Mathias; Khademi, Mohsen; Olsson, Tomas; Schwenk, Jochen M; Nilsson, Peter. Antibody-based profiling of cerebrospinal fluid within multiple sclerosis. Proteomics. 2013;13(15):2256-67. 

Remnestål, Julia; Just, David; Mitsios, Nicholas; Fredolini, Claudia; Mulder, Jan; Schwenk, Jochen M; Uhlén, Mathias; Kultima, Kim; Ingelsson, Martin; Kilander, Lena; Lannfelt, Lars; Svenningsson, Per; Nellgård, Bengt; Zetterberg, Henrik; Blennow, Kaj; Nilsson, Peter; Häggmark-Månberg, Anna. CSF profiling of the human brain enriched proteome reveals associations of neuromodulin and neurogranin to Alzheimer's disease. Proteomics. Clinical Applications. 2016;10(12):1242-1253.