Anti GALT pAb (ATL-HPA005729 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005729-25
  • Immunohistochemical staining of human gastrointestinal, liver, placenta and prostate using Anti-GALT antibody HPA005729 (A) shows similar protein distribution across tissues to independent antibody HPA004868 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: galactose-1-phosphate uridylyltransferase
Gene Name: GALT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036073: 91%, ENSRNOG00000014766: 88%
Entrez Gene ID: 2592
Uniprot ID: P07902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRETA
Gene Sequence SEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRETA
Gene ID - Mouse ENSMUSG00000036073
Gene ID - Rat ENSRNOG00000014766
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALT pAb (ATL-HPA005729 w/enhanced validation)
Datasheet Anti GALT pAb (ATL-HPA005729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALT pAb (ATL-HPA005729 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALT pAb (ATL-HPA005729 w/enhanced validation)
Datasheet Anti GALT pAb (ATL-HPA005729 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALT pAb (ATL-HPA005729 w/enhanced validation)



Citations for Anti GALT pAb (ATL-HPA005729 w/enhanced validation) – 1 Found
Barretta, Maria Luisa; Spano, Daniela; D'Ambrosio, Chiara; Cervigni, Romina Ines; Scaloni, Andrea; Corda, Daniela; Colanzi, Antonino. Aurora-A recruitment and centrosomal maturation are regulated by a Golgi-activated pool of Src during G2. Nature Communications. 2016;7( 27242098):11727.  PubMed
!