Anti GALT pAb (ATL-HPA005729 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005729-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GALT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036073: 91%, ENSRNOG00000014766: 88%
Entrez Gene ID: 2592
Uniprot ID: P07902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRETA |
| Gene Sequence | SEHWLVLVPFWATWPYQTLLLPRRHVRRLPELTPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGSEAGANWNHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRETA |
| Gene ID - Mouse | ENSMUSG00000036073 |
| Gene ID - Rat | ENSRNOG00000014766 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALT pAb (ATL-HPA005729 w/enhanced validation) | |
| Datasheet | Anti GALT pAb (ATL-HPA005729 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALT pAb (ATL-HPA005729 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti GALT pAb (ATL-HPA005729 w/enhanced validation) | |
| Datasheet | Anti GALT pAb (ATL-HPA005729 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti GALT pAb (ATL-HPA005729 w/enhanced validation) |
| Citations for Anti GALT pAb (ATL-HPA005729 w/enhanced validation) – 1 Found |
| Barretta, Maria Luisa; Spano, Daniela; D'Ambrosio, Chiara; Cervigni, Romina Ines; Scaloni, Andrea; Corda, Daniela; Colanzi, Antonino. Aurora-A recruitment and centrosomal maturation are regulated by a Golgi-activated pool of Src during G2. Nature Communications. 2016;7( 27242098):11727. PubMed |