Anti GALNTL6 pAb (ATL-HPA031019)

Atlas Antibodies

SKU: ATL-HPA031019-25

• 
• 

Protein Description: polypeptide N-acetylgalactosaminyltransferase-like 6
Gene Name: GALNTL6
Alternative Gene Name: GalNAc-T6L, GALNT17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096914: 93%, ENSRNOG00000002488: 37%
Entrez Gene ID: 442117
Uniprot ID: Q49A17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
• Gene Sequence: DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
• Gene ID - Mouse: ENSMUSG00000096914
• Gene ID - Rat: ENSRNOG00000002488
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GALNTL6 pAb (ATL-HPA031019) – 1 Found

Ju, Mingyi; Qi, Aoshuang; Bi, Jia; Zhao, Lan; Jiang, Longyang; Zhang, Qiang; Wei, Qian; Guan, Qiutong; Li, Xueping; Wang, Lin; Wei, Minjie; Zhao, Lin. A five-mRNA signature associated with post-translational modifications can better predict recurrence and survival in cervical cancer. Journal Of Cellular And Molecular Medicine. 2020;24(11):6283-6297.