Anti GALNTL6 pAb (ATL-HPA031019)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031019-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GALNTL6
Alternative Gene Name: GalNAc-T6L, GALNT17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096914: 93%, ENSRNOG00000002488: 37%
Entrez Gene ID: 442117
Uniprot ID: Q49A17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN |
| Gene Sequence | DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN |
| Gene ID - Mouse | ENSMUSG00000096914 |
| Gene ID - Rat | ENSRNOG00000002488 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALNTL6 pAb (ATL-HPA031019) | |
| Datasheet | Anti GALNTL6 pAb (ATL-HPA031019) Datasheet (External Link) |
| Vendor Page | Anti GALNTL6 pAb (ATL-HPA031019) at Atlas Antibodies |
| Documents & Links for Anti GALNTL6 pAb (ATL-HPA031019) | |
| Datasheet | Anti GALNTL6 pAb (ATL-HPA031019) Datasheet (External Link) |
| Vendor Page | Anti GALNTL6 pAb (ATL-HPA031019) |
| Citations for Anti GALNTL6 pAb (ATL-HPA031019) – 1 Found |
| Ju, Mingyi; Qi, Aoshuang; Bi, Jia; Zhao, Lan; Jiang, Longyang; Zhang, Qiang; Wei, Qian; Guan, Qiutong; Li, Xueping; Wang, Lin; Wei, Minjie; Zhao, Lin. A five-mRNA signature associated with post-translational modifications can better predict recurrence and survival in cervical cancer. Journal Of Cellular And Molecular Medicine. 2020;24(11):6283-6297. PubMed |