Anti GALNT8 pAb (ATL-HPA012638)

Atlas Antibodies

SKU:
ATL-HPA012638-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 8
Gene Name: GALNT8
Alternative Gene Name: GALNAC-T8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 42%, ENSRNOG00000017021: 41%
Entrez Gene ID: 26290
Uniprot ID: Q9NY28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVR
Gene Sequence NLLDENVCLDQGPFPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVR
Gene ID - Mouse ENSMUSG00000038296
Gene ID - Rat ENSRNOG00000017021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALNT8 pAb (ATL-HPA012638)
Datasheet Anti GALNT8 pAb (ATL-HPA012638) Datasheet (External Link)
Vendor Page Anti GALNT8 pAb (ATL-HPA012638) at Atlas Antibodies

Documents & Links for Anti GALNT8 pAb (ATL-HPA012638)
Datasheet Anti GALNT8 pAb (ATL-HPA012638) Datasheet (External Link)
Vendor Page Anti GALNT8 pAb (ATL-HPA012638)