Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA011762-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 6
Gene Name: GALNT6
Alternative Gene Name: GalNAc-T6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037280: 85%, ENSRNOG00000033059: 83%
Entrez Gene ID: 11226
Uniprot ID: Q8NCL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Gene Sequence LIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Gene ID - Mouse ENSMUSG00000037280
Gene ID - Rat ENSRNOG00000033059
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation)
Datasheet Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation)
Datasheet Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation)
Citations for Anti GALNT6 pAb (ATL-HPA011762 w/enhanced validation) – 1 Found
Ogawa, Makiko; Tanaka, Atsushi; Namba, Kei; Shia, Jinru; Wang, Julia Y; Roehrl, Michael H. Early-Stage Loss of GALNT6 Predicts Poor Clinical Outcome in Colorectal Cancer. Frontiers In Oncology. 12( 35692787):802548.  PubMed