Anti GALNT3 pAb (ATL-HPA007613 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007613-25

• 
• 

Protein Description: polypeptide N-acetylgalactosaminyltransferase 3
Gene Name: GALNT3
Alternative Gene Name: GalNAc-T3, HFTC, HHS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026994: 86%, ENSRNOG00000005727: 87%
Entrez Gene ID: 2591
Uniprot ID: Q14435
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
• Gene Sequence: EESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHC
• Gene ID - Mouse: ENSMUSG00000026994
• Gene ID - Rat: ENSRNOG00000005727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GALNT3 pAb (ATL-HPA007613 w/enhanced validation) – 3 Found

Lorenz, Virginia; Ditamo, Yanina; Cejas, Romina B; Carrizo, Maria E; Bennett, Eric P; Clausen, Henrik; Nores, Gustavo A; Irazoqui, Fernando J. Extrinsic Functions of Lectin Domains in O-N-Acetylgalactosamine Glycan Biosynthesis. The Journal Of Biological Chemistry. 2016;291(49):25339-25350. 

Stevenson, Nicola L; Bergen, Dylan J M; Skinner, Roderick E H; Kague, Erika; Martin-Silverstone, Elizabeth; Robson Brown, Kate A; Hammond, Chrissy L; Stephens, David J. Giantin-knockout models reveal a feedback loop between Golgi function and glycosyltransferase expression. Journal Of Cell Science. 2017;130(24):4132-4143. 

Cejas, Romina B; Lorenz, Virginia; Garay, Yohana C; Irazoqui, Fernando J. Biosynthesis of O-N-acetylgalactosamine glycans in the human cell nucleus. The Journal Of Biological Chemistry. 2019;294(9):2997-3011.