Anti GALNT18 pAb (ATL-HPA012955)

Atlas Antibodies

SKU:
ATL-HPA012955-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 18
Gene Name: GALNT18
Alternative Gene Name: GalNAc-T18, GALNT15, GALNTL4, MGC71806
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038296: 97%, ENSRNOG00000017021: 95%
Entrez Gene ID: 374378
Uniprot ID: Q6P9A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVL
Gene Sequence SDIIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRLIECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITNVL
Gene ID - Mouse ENSMUSG00000038296
Gene ID - Rat ENSRNOG00000017021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALNT18 pAb (ATL-HPA012955)
Datasheet Anti GALNT18 pAb (ATL-HPA012955) Datasheet (External Link)
Vendor Page Anti GALNT18 pAb (ATL-HPA012955) at Atlas Antibodies

Documents & Links for Anti GALNT18 pAb (ATL-HPA012955)
Datasheet Anti GALNT18 pAb (ATL-HPA012955) Datasheet (External Link)
Vendor Page Anti GALNT18 pAb (ATL-HPA012955)