Anti GALNT15 pAb (ATL-HPA017076)

Atlas Antibodies

SKU:
ATL-HPA017076-25
  • Immunohistochemical staining of human stomach shows strong positivity in Parietal cells.
  • Immunofluorescent staining of human cell line ASC TERT1 shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 15
Gene Name: GALNT15
Alternative Gene Name: GALNT7, GALNTL2, pp-GalNAc-T15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021903: 78%, ENSRNOG00000019718: 61%
Entrez Gene ID: 117248
Uniprot ID: Q8N3T1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG
Gene Sequence GGSVEILPCSRVGHIYQNQDSHSPLDQEATLRNRVRIAETWLGSFKETFYKHSPEAFSLSKAEKPDCMERLQLQRRLGCRTFHWFLANVYPELYPSEPRPSFSGKLHNTGLG
Gene ID - Mouse ENSMUSG00000021903
Gene ID - Rat ENSRNOG00000019718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALNT15 pAb (ATL-HPA017076)
Datasheet Anti GALNT15 pAb (ATL-HPA017076) Datasheet (External Link)
Vendor Page Anti GALNT15 pAb (ATL-HPA017076) at Atlas Antibodies

Documents & Links for Anti GALNT15 pAb (ATL-HPA017076)
Datasheet Anti GALNT15 pAb (ATL-HPA017076) Datasheet (External Link)
Vendor Page Anti GALNT15 pAb (ATL-HPA017076)



Citations for Anti GALNT15 pAb (ATL-HPA017076) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed