Anti GALNT10 pAb (ATL-HPA007525)

Atlas Antibodies

SKU:
ATL-HPA007525-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 10
Gene Name: GALNT10
Alternative Gene Name: GalNAc-T10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020520: 92%, ENSRNOG00000002488: 91%
Entrez Gene ID: 55568
Uniprot ID: Q86SR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
Gene Sequence AGQGSHSRQKKTFFLGDGQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRS
Gene ID - Mouse ENSMUSG00000020520
Gene ID - Rat ENSRNOG00000002488
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALNT10 pAb (ATL-HPA007525)
Datasheet Anti GALNT10 pAb (ATL-HPA007525) Datasheet (External Link)
Vendor Page Anti GALNT10 pAb (ATL-HPA007525) at Atlas Antibodies

Documents & Links for Anti GALNT10 pAb (ATL-HPA007525)
Datasheet Anti GALNT10 pAb (ATL-HPA007525) Datasheet (External Link)
Vendor Page Anti GALNT10 pAb (ATL-HPA007525)