Anti GALNT1 pAb (ATL-HPA012628)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012628-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GALNT1
Alternative Gene Name: GalNAc-T1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000420: 97%, ENSRNOG00000016207: 97%
Entrez Gene ID: 2589
Uniprot ID: Q10472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
| Gene Sequence | KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
| Gene ID - Mouse | ENSMUSG00000000420 |
| Gene ID - Rat | ENSRNOG00000016207 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALNT1 pAb (ATL-HPA012628) | |
| Datasheet | Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link) |
| Vendor Page | Anti GALNT1 pAb (ATL-HPA012628) at Atlas Antibodies |
| Documents & Links for Anti GALNT1 pAb (ATL-HPA012628) | |
| Datasheet | Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link) |
| Vendor Page | Anti GALNT1 pAb (ATL-HPA012628) |