Anti GALNT1 pAb (ATL-HPA012628)

Atlas Antibodies

Catalog No.:
ATL-HPA012628-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: polypeptide N-acetylgalactosaminyltransferase 1
Gene Name: GALNT1
Alternative Gene Name: GalNAc-T1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000420: 97%, ENSRNOG00000016207: 97%
Entrez Gene ID: 2589
Uniprot ID: Q10472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD
Gene Sequence KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD
Gene ID - Mouse ENSMUSG00000000420
Gene ID - Rat ENSRNOG00000016207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GALNT1 pAb (ATL-HPA012628)
Datasheet Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link)
Vendor Page Anti GALNT1 pAb (ATL-HPA012628) at Atlas Antibodies

Documents & Links for Anti GALNT1 pAb (ATL-HPA012628)
Datasheet Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link)
Vendor Page Anti GALNT1 pAb (ATL-HPA012628)