Anti GALNT1 pAb (ATL-HPA012628)
Atlas Antibodies
- SKU:
- ATL-HPA012628-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GALNT1
Alternative Gene Name: GalNAc-T1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000420: 97%, ENSRNOG00000016207: 97%
Entrez Gene ID: 2589
Uniprot ID: Q10472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
Gene Sequence | KERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPD |
Gene ID - Mouse | ENSMUSG00000000420 |
Gene ID - Rat | ENSRNOG00000016207 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GALNT1 pAb (ATL-HPA012628) | |
Datasheet | Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link) |
Vendor Page | Anti GALNT1 pAb (ATL-HPA012628) at Atlas Antibodies |
Documents & Links for Anti GALNT1 pAb (ATL-HPA012628) | |
Datasheet | Anti GALNT1 pAb (ATL-HPA012628) Datasheet (External Link) |
Vendor Page | Anti GALNT1 pAb (ATL-HPA012628) |