Anti GALM pAb (ATL-HPA035473 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA035473-100
  • Immunohistochemistry analysis in human kidney and skin tissues using Anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Kidney tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: galactose mutarotase (aldose 1-epimerase)
Gene Name: GALM
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035473: 88%, ENSRNOG00000007023: 89%
Entrez Gene ID: 130589
Uniprot ID: Q96C23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP
Gene Sequence PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP
Gene ID - Mouse ENSMUSG00000035473
Gene ID - Rat ENSRNOG00000007023
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALM pAb (ATL-HPA035473 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA035473 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA035473 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALM pAb (ATL-HPA035473 w/enhanced validation)
Datasheet Anti GALM pAb (ATL-HPA035473 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALM pAb (ATL-HPA035473 w/enhanced validation)