Anti GALK2 pAb (ATL-HPA043564)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043564-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: GALK2
Alternative Gene Name: GK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027207: 79%, ENSRNOG00000009289: 81%
Entrez Gene ID: 2585
Uniprot ID: Q01415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE |
| Gene Sequence | LVDICRKFGAQGSRLTGAGWGGCTVSMVPADKLPSFLANVHKAYYQRSDGSLAPEKQSLFATKPGGGALVLLE |
| Gene ID - Mouse | ENSMUSG00000027207 |
| Gene ID - Rat | ENSRNOG00000009289 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GALK2 pAb (ATL-HPA043564) | |
| Datasheet | Anti GALK2 pAb (ATL-HPA043564) Datasheet (External Link) |
| Vendor Page | Anti GALK2 pAb (ATL-HPA043564) at Atlas Antibodies |
| Documents & Links for Anti GALK2 pAb (ATL-HPA043564) | |
| Datasheet | Anti GALK2 pAb (ATL-HPA043564) Datasheet (External Link) |
| Vendor Page | Anti GALK2 pAb (ATL-HPA043564) |