Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA016960-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis using Anti-GALK1 antibody HPA016960 (A) shows similar pattern to independent antibody HPA007094 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: galactokinase 1
Gene Name: GALK1
Alternative Gene Name: GALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020766: 90%, ENSRNOG00000006359: 88%
Entrez Gene ID: 2584
Uniprot ID: P51570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQA
Gene Sequence MGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQA
Gene ID - Mouse ENSMUSG00000020766
Gene ID - Rat ENSRNOG00000006359
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation)
Datasheet Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation)
Datasheet Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GALK1 pAb (ATL-HPA016960 w/enhanced validation)