Anti GALE pAb (ATL-HPA007340)

Atlas Antibodies

Catalog No.: ATL-HPA007340-100

Protein Description: UDP-galactose-4-epimerase
Gene Name: GALE
Alternative Gene Name: SDR1E1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028671: 96%, ENSRNOG00000009712: 97%
Entrez Gene ID: 2582
Uniprot ID: Q14376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAA
• Gene Sequence: QGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAA
• Gene ID - Mouse: ENSMUSG00000028671
• Gene ID - Rat: ENSRNOG00000009712
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GALE pAb (ATL-HPA007340) – 1 Found

Murray, Thomas V; Kozakowska-McDonnell, Kasia; Tibbles, Adam; Taylor, Annabel; Higazi, Daniel; Rossy, Emmanuel; Rossi, Alessandra; Genapathy, Sivaneswary; Tamburrino, Giulia; Rath, Nicola; Tigue, Natalie; Lindo, Vivian; Vaughan, Tristan; Papworth, Monika A. An efficient system for bioconjugation based on a widely applicable engineered O-glycosylation tag. Mabs. 2021;13(1):1992068.