Anti GAGE1 pAb (ATL-HPA043232)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043232-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: GAGE1
Alternative Gene Name: CT4.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006014: 39%, ENSRNOG00000026243: 41%
Entrez Gene ID: 2543
Uniprot ID: Q13068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA |
| Gene Sequence | PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA |
| Gene ID - Mouse | ENSMUSG00000006014 |
| Gene ID - Rat | ENSRNOG00000026243 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAGE1 pAb (ATL-HPA043232) | |
| Datasheet | Anti GAGE1 pAb (ATL-HPA043232) Datasheet (External Link) |
| Vendor Page | Anti GAGE1 pAb (ATL-HPA043232) at Atlas Antibodies |
| Documents & Links for Anti GAGE1 pAb (ATL-HPA043232) | |
| Datasheet | Anti GAGE1 pAb (ATL-HPA043232) Datasheet (External Link) |
| Vendor Page | Anti GAGE1 pAb (ATL-HPA043232) |