Anti GAGE1 pAb (ATL-HPA043232)

Atlas Antibodies

SKU:
ATL-HPA043232-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in subset of cells in seminiferous ducts.
  • Western blot analysis in human cell line AN3-CA.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: G antigen 1
Gene Name: GAGE1
Alternative Gene Name: CT4.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006014: 39%, ENSRNOG00000026243: 41%
Entrez Gene ID: 2543
Uniprot ID: Q13068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA
Gene Sequence PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA
Gene ID - Mouse ENSMUSG00000006014
Gene ID - Rat ENSRNOG00000026243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GAGE1 pAb (ATL-HPA043232)
Datasheet Anti GAGE1 pAb (ATL-HPA043232) Datasheet (External Link)
Vendor Page Anti GAGE1 pAb (ATL-HPA043232) at Atlas Antibodies

Documents & Links for Anti GAGE1 pAb (ATL-HPA043232)
Datasheet Anti GAGE1 pAb (ATL-HPA043232) Datasheet (External Link)
Vendor Page Anti GAGE1 pAb (ATL-HPA043232)