Anti GADD45G pAb (ATL-HPA023606)

Atlas Antibodies

SKU: ATL-HPA023606-100

• 
• 
• 

Protein Description: growth arrest and DNA-damage-inducible, gamma
Gene Name: GADD45G
Alternative Gene Name: CR6, DDIT2, GADD45gamma, GRP17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021453: 99%, ENSRNOG00000013090: 99%
Entrez Gene ID: 10912
Uniprot ID: O95257
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVG
• Gene Sequence: MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVG
• Gene ID - Mouse: ENSMUSG00000021453
• Gene ID - Rat: ENSRNOG00000013090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.