Anti GADD45B pAb (ATL-HPA029816)

Atlas Antibodies

Catalog No.: ATL-HPA029816-25

Protein Description: growth arrest and DNA-damage-inducible, beta
Gene Name: GADD45B
Alternative Gene Name: DKFZP566B133, GADD45BETA, MYD118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015312: 95%, ENSRNOG00000019822: 94%
Entrez Gene ID: 4616
Uniprot ID: O75293
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
• Gene Sequence: AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPY
• Gene ID - Mouse: ENSMUSG00000015312
• Gene ID - Rat: ENSRNOG00000019822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GADD45B pAb (ATL-HPA029816) – 2 Found

Myint, Kyaw Zwar; Kongpracha, Pornparn; Rattanasinganchan, Panthip; Leelawat, Kawin; Moolthiya, Penpak; Chaiyabutr, Kittipong; Tohtong, Rutaiwan. Gadd45β silencing impaired viability and metastatic phenotypes in cholangiocarcinoma cells by modulating the EMT pathway. Oncology Letters. 2018;15(3):3031-3041. 

Rizzardi, Anthony E; Rosener, Nikolaus K; Koopmeiners, Joseph S; Isaksson Vogel, Rachel; Metzger, Gregory J; Forster, Colleen L; Marston, Lauren O; Tiffany, Jessica R; McCarthy, James B; Turley, Eva A; Warlick, Christopher A; Henriksen, Jonathan C; Schmechel, Stephen C. Evaluation of protein biomarkers of prostate cancer aggressiveness. Bmc Cancer. 2014;14( 24708576):244.