Anti GAD1 pAb (ATL-HPA048871)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048871-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GAD1
Alternative Gene Name: GAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070880: 97%, ENSRNOG00000000007: 97%
Entrez Gene ID: 2571
Uniprot ID: Q99259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER |
| Gene Sequence | SSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKER |
| Gene ID - Mouse | ENSMUSG00000070880 |
| Gene ID - Rat | ENSRNOG00000000007 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAD1 pAb (ATL-HPA048871) | |
| Datasheet | Anti GAD1 pAb (ATL-HPA048871) Datasheet (External Link) |
| Vendor Page | Anti GAD1 pAb (ATL-HPA048871) at Atlas Antibodies |
| Documents & Links for Anti GAD1 pAb (ATL-HPA048871) | |
| Datasheet | Anti GAD1 pAb (ATL-HPA048871) Datasheet (External Link) |
| Vendor Page | Anti GAD1 pAb (ATL-HPA048871) |