Anti GABRG1 pAb (ATL-HPA035622)

Atlas Antibodies

SKU: ATL-HPA035622-25

• 

Protein Description: gamma-aminobutyric acid (GABA) A receptor, gamma 1
Gene Name: GABRG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001260: 96%, ENSRNOG00000002360: 94%
Entrez Gene ID: 2565
Uniprot ID: Q8N1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
• Gene Sequence: RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
• Gene ID - Mouse: ENSMUSG00000001260
• Gene ID - Rat: ENSRNOG00000002360
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GABRG1 pAb (ATL-HPA035622) – 1 Found

Smits, Anja; Jin, Zhe; Elsir, Tamador; Pedder, Hugo; Nistér, Monica; Alafuzoff, Irina; Dimberg, Anna; Edqvist, Per-Henrik; Pontén, Fredrik; Aronica, Eleonora; Birnir, Bryndis. GABA-A channel subunit expression in human glioma correlates with tumor histology and clinical outcome. Plos One. 7(5):e37041.