Anti GABRG1 pAb (ATL-HPA035622)

Atlas Antibodies

Catalog No.:
ATL-HPA035622-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) A receptor, gamma 1
Gene Name: GABRG1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001260: 96%, ENSRNOG00000002360: 94%
Entrez Gene ID: 2565
Uniprot ID: Q8N1C3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
Gene Sequence RGVRLVFLLLTLHLGNCVDKADDEDDEDLTVNKTWVLAPKIHEGDITQIL
Gene ID - Mouse ENSMUSG00000001260
Gene ID - Rat ENSRNOG00000002360
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRG1 pAb (ATL-HPA035622)
Datasheet Anti GABRG1 pAb (ATL-HPA035622) Datasheet (External Link)
Vendor Page Anti GABRG1 pAb (ATL-HPA035622) at Atlas Antibodies

Documents & Links for Anti GABRG1 pAb (ATL-HPA035622)
Datasheet Anti GABRG1 pAb (ATL-HPA035622) Datasheet (External Link)
Vendor Page Anti GABRG1 pAb (ATL-HPA035622)
Citations for Anti GABRG1 pAb (ATL-HPA035622) – 1 Found
Smits, Anja; Jin, Zhe; Elsir, Tamador; Pedder, Hugo; Nistér, Monica; Alafuzoff, Irina; Dimberg, Anna; Edqvist, Per-Henrik; Pontén, Fredrik; Aronica, Eleonora; Birnir, Bryndis. GABA-A channel subunit expression in human glioma correlates with tumor histology and clinical outcome. Plos One. 7(5):e37041.  PubMed