Anti GABRE pAb (ATL-HPA045918)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045918-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: GABRE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031340: 58%, ENSRNOG00000061182: 60%
Entrez Gene ID: 2564
Uniprot ID: P78334
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL |
| Gene Sequence | PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL |
| Gene ID - Mouse | ENSMUSG00000031340 |
| Gene ID - Rat | ENSRNOG00000061182 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GABRE pAb (ATL-HPA045918) | |
| Datasheet | Anti GABRE pAb (ATL-HPA045918) Datasheet (External Link) |
| Vendor Page | Anti GABRE pAb (ATL-HPA045918) at Atlas Antibodies |
| Documents & Links for Anti GABRE pAb (ATL-HPA045918) | |
| Datasheet | Anti GABRE pAb (ATL-HPA045918) Datasheet (External Link) |
| Vendor Page | Anti GABRE pAb (ATL-HPA045918) |
| Citations for Anti GABRE pAb (ATL-HPA045918) – 2 Found |
| Gami-Patel, P; van Dijken, I; van Swieten, J C; Pijnenburg, Y A L; Rozemuller, A J M; Hoozemans, J J M; Dijkstra, A A. Von Economo neurons are part of a larger neuronal population that are selectively vulnerable in C9orf72 frontotemporal dementia. Neuropathology And Applied Neurobiology. 2019;45(7):671-680. PubMed |
| Singleton, E H; Pijnenburg, Y A L; Gami-Patel, P; Boon, B D C; Bouwman, F; Papma, J M; Seelaar, H; Scheltens, P; Grinberg, L T; Spina, S; Nana, A L; Rabinovici, G D; Seeley, W W; Ossenkoppele, R; Dijkstra, A A. The behavioral variant of Alzheimer's disease does not show a selective loss of Von Economo and phylogenetically related neurons in the anterior cingulate cortex. Alzheimer's Research & Therapy. 2022;14(1):11. PubMed |