Anti GABRE pAb (ATL-HPA045918)

Atlas Antibodies

Catalog No.:
ATL-HPA045918-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) A receptor, epsilon
Gene Name: GABRE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031340: 58%, ENSRNOG00000061182: 60%
Entrez Gene ID: 2564
Uniprot ID: P78334
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL
Gene Sequence PQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEIAVNSLGPL
Gene ID - Mouse ENSMUSG00000031340
Gene ID - Rat ENSRNOG00000061182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRE pAb (ATL-HPA045918)
Datasheet Anti GABRE pAb (ATL-HPA045918) Datasheet (External Link)
Vendor Page Anti GABRE pAb (ATL-HPA045918) at Atlas Antibodies

Documents & Links for Anti GABRE pAb (ATL-HPA045918)
Datasheet Anti GABRE pAb (ATL-HPA045918) Datasheet (External Link)
Vendor Page Anti GABRE pAb (ATL-HPA045918)
Citations for Anti GABRE pAb (ATL-HPA045918) – 2 Found
Gami-Patel, P; van Dijken, I; van Swieten, J C; Pijnenburg, Y A L; Rozemuller, A J M; Hoozemans, J J M; Dijkstra, A A. Von Economo neurons are part of a larger neuronal population that are selectively vulnerable in C9orf72 frontotemporal dementia. Neuropathology And Applied Neurobiology. 2019;45(7):671-680.  PubMed
Singleton, E H; Pijnenburg, Y A L; Gami-Patel, P; Boon, B D C; Bouwman, F; Papma, J M; Seelaar, H; Scheltens, P; Grinberg, L T; Spina, S; Nana, A L; Rabinovici, G D; Seeley, W W; Ossenkoppele, R; Dijkstra, A A. The behavioral variant of Alzheimer's disease does not show a selective loss of Von Economo and phylogenetically related neurons in the anterior cingulate cortex. Alzheimer's Research & Therapy. 2022;14(1):11.  PubMed