Anti GABRA3 pAb (ATL-HPA000839)

Atlas Antibodies

Catalog No.:
ATL-HPA000839-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: gamma-aminobutyric acid (GABA) A receptor, alpha 3
Gene Name: GABRA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031343: 91%, ENSRNOG00000056558: 93%
Entrez Gene ID: 2556
Uniprot ID: P34903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE
Gene Sequence TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE
Gene ID - Mouse ENSMUSG00000031343
Gene ID - Rat ENSRNOG00000056558
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABRA3 pAb (ATL-HPA000839)
Datasheet Anti GABRA3 pAb (ATL-HPA000839) Datasheet (External Link)
Vendor Page Anti GABRA3 pAb (ATL-HPA000839) at Atlas Antibodies

Documents & Links for Anti GABRA3 pAb (ATL-HPA000839)
Datasheet Anti GABRA3 pAb (ATL-HPA000839) Datasheet (External Link)
Vendor Page Anti GABRA3 pAb (ATL-HPA000839)
Citations for Anti GABRA3 pAb (ATL-HPA000839) – 3 Found
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.  PubMed
Patil, Vikas; Pal, Jagriti; Mahalingam, Kulandaivelu; Somasundaram, Kumaravel. Global RNA editome landscape discovers reduced RNA editing in glioma: loss of editing of gamma-amino butyric acid receptor alpha subunit 3 (GABRA3) favors glioma migration and invasion. Peerj. 8( 33062411):e9755.  PubMed
Rosenthal, Sara Brin; Liu, Xiao; Ganguly, Souradipta; Dhar, Debanjan; Pasillas, Martina P; Ricciardelli, Eugenia; Li, Rick Z; Troutman, Ty D; Kisseleva, Tatiana; Glass, Christopher K; Brenner, David A. Heterogeneity of HSCs in a Mouse Model of NASH. Hepatology (Baltimore, Md.). 2021;74(2):667-685.  PubMed