Anti GABPA pAb (ATL-HPA028791 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028791-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: GA binding protein transcription factor, alpha subunit 60kDa
Gene Name: GABPA
Alternative Gene Name: E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008976: 89%, ENSRNOG00000053205: 99%
Entrez Gene ID: 2551
Uniprot ID: Q06546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Gene Sequence YDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN
Gene ID - Mouse ENSMUSG00000008976
Gene ID - Rat ENSRNOG00000053205
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GABPA pAb (ATL-HPA028791 w/enhanced validation)
Datasheet Anti GABPA pAb (ATL-HPA028791 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABPA pAb (ATL-HPA028791 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GABPA pAb (ATL-HPA028791 w/enhanced validation)
Datasheet Anti GABPA pAb (ATL-HPA028791 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GABPA pAb (ATL-HPA028791 w/enhanced validation)