Anti GABPA pAb (ATL-HPA003258)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003258-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: GABPA
Alternative Gene Name: E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008976: 96%, ENSRNOG00000053205: 97%
Entrez Gene ID: 2551
Uniprot ID: Q06546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK |
Gene Sequence | EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK |
Gene ID - Mouse | ENSMUSG00000008976 |
Gene ID - Rat | ENSRNOG00000053205 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GABPA pAb (ATL-HPA003258) | |
Datasheet | Anti GABPA pAb (ATL-HPA003258) Datasheet (External Link) |
Vendor Page | Anti GABPA pAb (ATL-HPA003258) at Atlas Antibodies |
Documents & Links for Anti GABPA pAb (ATL-HPA003258) | |
Datasheet | Anti GABPA pAb (ATL-HPA003258) Datasheet (External Link) |
Vendor Page | Anti GABPA pAb (ATL-HPA003258) |
Citations for Anti GABPA pAb (ATL-HPA003258) – 1 Found |
Sharma, Naomi L; Massie, Charlie E; Butter, Falk; Mann, Matthias; Bon, Helene; Ramos-Montoya, Antonio; Menon, Suraj; Stark, Rory; Lamb, Alastair D; Scott, Helen E; Warren, Anne Y; Neal, David E; Mills, Ian G. The ETS family member GABPα modulates androgen receptor signalling and mediates an aggressive phenotype in prostate cancer. Nucleic Acids Research. 2014;42(10):6256-69. PubMed |