Anti GABPA pAb (ATL-HPA003258)

Atlas Antibodies

SKU:
ATL-HPA003258-25
  • Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in human cell line Daudi.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: GA binding protein transcription factor, alpha subunit 60kDa
Gene Name: GABPA
Alternative Gene Name: E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008976: 96%, ENSRNOG00000053205: 97%
Entrez Gene ID: 2551
Uniprot ID: Q06546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Gene Sequence EELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
Gene ID - Mouse ENSMUSG00000008976
Gene ID - Rat ENSRNOG00000053205
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti GABPA pAb (ATL-HPA003258)
Datasheet Anti GABPA pAb (ATL-HPA003258) Datasheet (External Link)
Vendor Page Anti GABPA pAb (ATL-HPA003258) at Atlas Antibodies

Documents & Links for Anti GABPA pAb (ATL-HPA003258)
Datasheet Anti GABPA pAb (ATL-HPA003258) Datasheet (External Link)
Vendor Page Anti GABPA pAb (ATL-HPA003258)



Citations for Anti GABPA pAb (ATL-HPA003258) – 1 Found
Sharma, Naomi L; Massie, Charlie E; Butter, Falk; Mann, Matthias; Bon, Helene; Ramos-Montoya, Antonio; Menon, Suraj; Stark, Rory; Lamb, Alastair D; Scott, Helen E; Warren, Anne Y; Neal, David E; Mills, Ian G. The ETS family member GABPα modulates androgen receptor signalling and mediates an aggressive phenotype in prostate cancer. Nucleic Acids Research. 2014;42(10):6256-69.  PubMed