Anti GABARAPL2 pAb (ATL-HPA036726)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036726-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GABARAPL2
Alternative Gene Name: ATG8, ATG8C, GATE-16, GATE16, GEF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031950: 100%, ENSRNOG00000019425: 100%
Entrez Gene ID: 11345
Uniprot ID: P60520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE |
Gene Sequence | SDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKE |
Gene ID - Mouse | ENSMUSG00000031950 |
Gene ID - Rat | ENSRNOG00000019425 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GABARAPL2 pAb (ATL-HPA036726) | |
Datasheet | Anti GABARAPL2 pAb (ATL-HPA036726) Datasheet (External Link) |
Vendor Page | Anti GABARAPL2 pAb (ATL-HPA036726) at Atlas Antibodies |
Documents & Links for Anti GABARAPL2 pAb (ATL-HPA036726) | |
Datasheet | Anti GABARAPL2 pAb (ATL-HPA036726) Datasheet (External Link) |
Vendor Page | Anti GABARAPL2 pAb (ATL-HPA036726) |
Citations for Anti GABARAPL2 pAb (ATL-HPA036726) – 2 Found |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
Sun, Liangbo; Xiong, Haojun; Chen, Lingxi; Dai, Xufang; Yan, Xiaojing; Wu, Yaran; Yang, Mingzhen; Shan, Meihua; Li, Tao; Yao, Jie; Jiang, Wenbin; He, Haiyan; He, Fengtian; Lian, Jiqin. Deacetylation of ATG4B promotes autophagy initiation under starvation. Science Advances. 2022;8(31):eabo0412. PubMed |