Anti GAB4 pAb (ATL-HPA044621)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044621-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: GAB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 46%, ENSRNOG00000011882: 44%
Entrez Gene ID: 128954
Uniprot ID: Q2WGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE |
Gene Sequence | ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE |
Gene ID - Mouse | ENSMUSG00000004508 |
Gene ID - Rat | ENSRNOG00000011882 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAB4 pAb (ATL-HPA044621) | |
Datasheet | Anti GAB4 pAb (ATL-HPA044621) Datasheet (External Link) |
Vendor Page | Anti GAB4 pAb (ATL-HPA044621) at Atlas Antibodies |
Documents & Links for Anti GAB4 pAb (ATL-HPA044621) | |
Datasheet | Anti GAB4 pAb (ATL-HPA044621) Datasheet (External Link) |
Vendor Page | Anti GAB4 pAb (ATL-HPA044621) |