Anti GAB4 pAb (ATL-HPA044621)

Atlas Antibodies

Catalog No.: ATL-HPA044621-25

Protein Description: GRB2-associated binding protein family, member 4
Gene Name: GAB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 46%, ENSRNOG00000011882: 44%
Entrez Gene ID: 128954
Uniprot ID: Q2WGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE
• Gene Sequence: ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE
• Gene ID - Mouse: ENSMUSG00000004508
• Gene ID - Rat: ENSRNOG00000011882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.