Anti GAB4 pAb (ATL-HPA044621)

Atlas Antibodies

Catalog No.:
ATL-HPA044621-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: GRB2-associated binding protein family, member 4
Gene Name: GAB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 46%, ENSRNOG00000011882: 44%
Entrez Gene ID: 128954
Uniprot ID: Q2WGN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE
Gene Sequence ESTGFLGNISSASHGLCSSPAEPSCSHQHLPQEQEPTSEPPVSHCVPPTWPIPAPPGCLRSHQHASQRAE
Gene ID - Mouse ENSMUSG00000004508
Gene ID - Rat ENSRNOG00000011882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAB4 pAb (ATL-HPA044621)
Datasheet Anti GAB4 pAb (ATL-HPA044621) Datasheet (External Link)
Vendor Page Anti GAB4 pAb (ATL-HPA044621) at Atlas Antibodies

Documents & Links for Anti GAB4 pAb (ATL-HPA044621)
Datasheet Anti GAB4 pAb (ATL-HPA044621) Datasheet (External Link)
Vendor Page Anti GAB4 pAb (ATL-HPA044621)