Anti GAB2 pAb (ATL-HPA001368)

Atlas Antibodies

Catalog No.: ATL-HPA001368-25

Protein Description: GRB2-associated binding protein 2
Gene Name: GAB2
Alternative Gene Name: KIAA0571
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 88%, ENSRNOG00000011882: 85%
Entrez Gene ID: 9846
Uniprot ID: Q9UQC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
• Gene Sequence: LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
• Gene ID - Mouse: ENSMUSG00000004508
• Gene ID - Rat: ENSRNOG00000011882
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GAB2 pAb (ATL-HPA001368) – 1 Found

Jochner, Magdalena C E; An, Junfeng; Lättig-Tünnemann, Gisela; Kirchner, Marieluise; Dagane, Alina; Dittmar, Gunnar; Dirnagl, Ulrich; Eickholt, Britta J; Harms, Christoph. Unique properties of PTEN-L contribute to neuroprotection in response to ischemic-like stress. Scientific Reports. 2019;9(1):3183.