Anti GAB2 pAb (ATL-HPA001368)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001368-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GAB2
Alternative Gene Name: KIAA0571
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 88%, ENSRNOG00000011882: 85%
Entrez Gene ID: 9846
Uniprot ID: Q9UQC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST |
Gene Sequence | LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST |
Gene ID - Mouse | ENSMUSG00000004508 |
Gene ID - Rat | ENSRNOG00000011882 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti GAB2 pAb (ATL-HPA001368) | |
Datasheet | Anti GAB2 pAb (ATL-HPA001368) Datasheet (External Link) |
Vendor Page | Anti GAB2 pAb (ATL-HPA001368) at Atlas Antibodies |
Documents & Links for Anti GAB2 pAb (ATL-HPA001368) | |
Datasheet | Anti GAB2 pAb (ATL-HPA001368) Datasheet (External Link) |
Vendor Page | Anti GAB2 pAb (ATL-HPA001368) |
Citations for Anti GAB2 pAb (ATL-HPA001368) – 1 Found |
Jochner, Magdalena C E; An, Junfeng; Lättig-Tünnemann, Gisela; Kirchner, Marieluise; Dagane, Alina; Dittmar, Gunnar; Dirnagl, Ulrich; Eickholt, Britta J; Harms, Christoph. Unique properties of PTEN-L contribute to neuroprotection in response to ischemic-like stress. Scientific Reports. 2019;9(1):3183. PubMed |