Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000271-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: GRB2-associated binding protein 2
Gene Name: GAB2
Alternative Gene Name: KIAA0571
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004508: 88%, ENSRNOG00000011882: 85%
Entrez Gene ID: 9846
Uniprot ID: Q9UQC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Gene Sequence LSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQEYLYLHQCISRRAENARSASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFYSLPKPSRHNTEFRDST
Gene ID - Mouse ENSMUSG00000004508
Gene ID - Rat ENSRNOG00000011882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation)
Datasheet Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation)
Datasheet Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation)
Citations for Anti GAB2 pAb (ATL-HPA000271 w/enhanced validation) – 1 Found
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed