Anti GAA pAb (ATL-HPA026970)

Atlas Antibodies

Catalog No.:
ATL-HPA026970-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: glucosidase, alpha; acid
Gene Name: GAA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025579: 84%, ENSRNOG00000047656: 83%
Entrez Gene ID: 2548
Uniprot ID: P10253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS
Gene Sequence SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS
Gene ID - Mouse ENSMUSG00000025579
Gene ID - Rat ENSRNOG00000047656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti GAA pAb (ATL-HPA026970)
Datasheet Anti GAA pAb (ATL-HPA026970) Datasheet (External Link)
Vendor Page Anti GAA pAb (ATL-HPA026970) at Atlas Antibodies

Documents & Links for Anti GAA pAb (ATL-HPA026970)
Datasheet Anti GAA pAb (ATL-HPA026970) Datasheet (External Link)
Vendor Page Anti GAA pAb (ATL-HPA026970)