Anti GAA pAb (ATL-HPA026970)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026970-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: GAA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025579: 84%, ENSRNOG00000047656: 83%
Entrez Gene ID: 2548
Uniprot ID: P10253
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS |
| Gene Sequence | SSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTS |
| Gene ID - Mouse | ENSMUSG00000025579 |
| Gene ID - Rat | ENSRNOG00000047656 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti GAA pAb (ATL-HPA026970) | |
| Datasheet | Anti GAA pAb (ATL-HPA026970) Datasheet (External Link) |
| Vendor Page | Anti GAA pAb (ATL-HPA026970) at Atlas Antibodies |
| Documents & Links for Anti GAA pAb (ATL-HPA026970) | |
| Datasheet | Anti GAA pAb (ATL-HPA026970) Datasheet (External Link) |
| Vendor Page | Anti GAA pAb (ATL-HPA026970) |