Anti G6PD pAb (ATL-HPA000247 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000247-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: glucose-6-phosphate dehydrogenase
Gene Name: G6PD
Alternative Gene Name: G6PD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031400: 96%, ENSRNOG00000056728: 96%
Entrez Gene ID: 2539
Uniprot ID: P11413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP
Gene Sequence EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP
Gene ID - Mouse ENSMUSG00000031400
Gene ID - Rat ENSRNOG00000056728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation)
Datasheet Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation)
Datasheet Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti G6PD pAb (ATL-HPA000247 w/enhanced validation)
Citations for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) – 7 Found
Vlahakis, Ariadne; Lopez Muniozguren, Nerea; Powers, Ted. Stress-response transcription factors Msn2 and Msn4 couple TORC2-Ypk1 signaling and mitochondrial respiration to ATG8 gene expression and autophagy. Autophagy. 13(11):1804-1812.  PubMed
Hambardikar, Vedangi; Guitart-Mampel, Mariona; Scoma, Ernest R; Urquiza, Pedro; Nagana, Gowda G A; Raftery, Daniel; Collins, John A; Solesio, Maria E. Enzymatic Depletion of Mitochondrial Inorganic Polyphosphate (polyP) Increases the Generation of Reactive Oxygen Species (ROS) and the Activity of the Pentose Phosphate Pathway (PPP) in Mammalian Cells. Antioxidants (Basel, Switzerland). 2022;11(4)  PubMed
Dammeyer, Pascal; Arnér, Elias S J. Human Protein Atlas of redox systems - what can be learnt?. Biochimica Et Biophysica Acta. 2011;1810(1):111-38.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Zheng, Liangde; Shu, Wen-Jie; Li, Yu-Min; Mari, Muriel; Yan, Chaojun; Wang, Dehe; Yin, Zhao-Hong; Jiang, Wei; Zhou, Yu; Okamoto, Koji; Reggiori, Fulvio; Klionsky, Daniel J; Song, Zhiyin; Du, Hai-Ning. The Paf1 complex transcriptionally regulates the mitochondrial-anchored protein Atg32 leading to activation of mitophagy. Autophagy. 2020;16(8):1366-1379.  PubMed
Duroux, Romain; Mandeau, Anne; Guiraudie-Capraz, Gaelle; Quesnel, Yannick; Loing, Estelle. A Rose Extract Protects the Skin against Stress Mediators: A Potential Role of Olfactory Receptors. Molecules (Basel, Switzerland). 2020;25(20)  PubMed
Nakamura, Motoki; Nagase, Kotaro; Yoshimitsu, Maki; Magara, Tetsuya; Nojiri, Yuka; Kato, Hiroshi; Kobayashi, Tadahiro; Teramoto, Yukiko; Yasuda, Masahito; Wada, Hidefumi; Ozawa, Toshiyuki; Umemori, Yukie; Ogata, Dai; Morita, Akimichi. Glucose-6-phosphate dehydrogenase correlates with tumor immune activity and programmed death ligand-1 expression in Merkel cell carcinoma. Journal For Immunotherapy Of Cancer. 2020;8(2)  PubMed