Anti G6PD pAb (ATL-HPA000247 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000247-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: G6PD
Alternative Gene Name: G6PD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031400: 96%, ENSRNOG00000056728: 96%
Entrez Gene ID: 2539
Uniprot ID: P11413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP |
| Gene Sequence | EVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKP |
| Gene ID - Mouse | ENSMUSG00000031400 |
| Gene ID - Rat | ENSRNOG00000056728 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) | |
| Datasheet | Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) | |
| Datasheet | Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) |
| Citations for Anti G6PD pAb (ATL-HPA000247 w/enhanced validation) – 7 Found |
| Vlahakis, Ariadne; Lopez Muniozguren, Nerea; Powers, Ted. Stress-response transcription factors Msn2 and Msn4 couple TORC2-Ypk1 signaling and mitochondrial respiration to ATG8 gene expression and autophagy. Autophagy. 13(11):1804-1812. PubMed |
| Hambardikar, Vedangi; Guitart-Mampel, Mariona; Scoma, Ernest R; Urquiza, Pedro; Nagana, Gowda G A; Raftery, Daniel; Collins, John A; Solesio, Maria E. Enzymatic Depletion of Mitochondrial Inorganic Polyphosphate (polyP) Increases the Generation of Reactive Oxygen Species (ROS) and the Activity of the Pentose Phosphate Pathway (PPP) in Mammalian Cells. Antioxidants (Basel, Switzerland). 2022;11(4) PubMed |
| Dammeyer, Pascal; Arnér, Elias S J. Human Protein Atlas of redox systems - what can be learnt?. Biochimica Et Biophysica Acta. 2011;1810(1):111-38. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Zheng, Liangde; Shu, Wen-Jie; Li, Yu-Min; Mari, Muriel; Yan, Chaojun; Wang, Dehe; Yin, Zhao-Hong; Jiang, Wei; Zhou, Yu; Okamoto, Koji; Reggiori, Fulvio; Klionsky, Daniel J; Song, Zhiyin; Du, Hai-Ning. The Paf1 complex transcriptionally regulates the mitochondrial-anchored protein Atg32 leading to activation of mitophagy. Autophagy. 2020;16(8):1366-1379. PubMed |
| Duroux, Romain; Mandeau, Anne; Guiraudie-Capraz, Gaelle; Quesnel, Yannick; Loing, Estelle. A Rose Extract Protects the Skin against Stress Mediators: A Potential Role of Olfactory Receptors. Molecules (Basel, Switzerland). 2020;25(20) PubMed |
| Nakamura, Motoki; Nagase, Kotaro; Yoshimitsu, Maki; Magara, Tetsuya; Nojiri, Yuka; Kato, Hiroshi; Kobayashi, Tadahiro; Teramoto, Yukiko; Yasuda, Masahito; Wada, Hidefumi; Ozawa, Toshiyuki; Umemori, Yukie; Ogata, Dai; Morita, Akimichi. Glucose-6-phosphate dehydrogenase correlates with tumor immune activity and programmed death ligand-1 expression in Merkel cell carcinoma. Journal For Immunotherapy Of Cancer. 2020;8(2) PubMed |