Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018425-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: G3BP2
Alternative Gene Name: KIAA0660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029405: 94%, ENSRNOG00000002433: 92%
Entrez Gene ID: 9908
Uniprot ID: Q9UN86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS |
| Gene Sequence | KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS |
| Gene ID - Mouse | ENSMUSG00000029405 |
| Gene ID - Rat | ENSRNOG00000002433 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) | |
| Datasheet | Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) | |
| Datasheet | Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) |
| Citations for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) – 1 Found |
| Wei, Spencer C; Fattet, Laurent; Tsai, Jeff H; Guo, Yurong; Pai, Vincent H; Majeski, Hannah E; Chen, Albert C; Sah, Robert L; Taylor, Susan S; Engler, Adam J; Yang, Jing. Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Nature Cell Biology. 2015;17(5):678-88. PubMed |