Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018425-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: GTPase activating protein (SH3 domain) binding protein 2
Gene Name: G3BP2
Alternative Gene Name: KIAA0660
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029405: 94%, ENSRNOG00000002433: 92%
Entrez Gene ID: 9908
Uniprot ID: Q9UN86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Gene Sequence KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS
Gene ID - Mouse ENSMUSG00000029405
Gene ID - Rat ENSRNOG00000002433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation)
Datasheet Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation)
Datasheet Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation)
Citations for Anti G3BP2 pAb (ATL-HPA018425 w/enhanced validation) – 1 Found
Wei, Spencer C; Fattet, Laurent; Tsai, Jeff H; Guo, Yurong; Pai, Vincent H; Majeski, Hannah E; Chen, Albert C; Sah, Robert L; Taylor, Susan S; Engler, Adam J; Yang, Jing. Matrix stiffness drives epithelial-mesenchymal transition and tumour metastasis through a TWIST1-G3BP2 mechanotransduction pathway. Nature Cell Biology. 2015;17(5):678-88.  PubMed